Lineage for d1mmfe_ (1mmf E:)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1856157Fold c.51: Anticodon-binding domain-like [52953] (6 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of five strands, order 21345; strand 4 is antiparallel to the rest
  4. 1856336Superfamily c.51.3: B12-dependent dehydatase associated subunit [52968] (2 families) (S)
  5. 1856337Family c.51.3.1: Diol dehydratase, beta subunit [52969] (1 protein)
    contains additional structures in the C-terminal extension
  6. 1856338Protein Diol dehydratase, beta subunit [52970] (2 species)
  7. 1856356Species Klebsiella pneumoniae [TaxId:573] [82432] (2 PDB entries)
  8. 1856360Domain d1mmfe_: 1mmf E: [85020]
    Other proteins in same PDB: d1mmfa_, d1mmfg_, d1mmfl_, d1mmfm_
    complexed with b12, k

Details for d1mmfe_

PDB Entry: 1mmf (more details), 2.5 Å

PDB Description: Crystal structure of substrate free form of glycerol dehydratase
PDB Compounds: (E:) glycerol dehydrase beta subunit

SCOPe Domain Sequences for d1mmfe_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1mmfe_ c.51.3.1 (E:) Diol dehydratase, beta subunit {Klebsiella pneumoniae [TaxId: 573]}
sftlktreggvasaderadevvigvgpafdkhqhhtlidmphgailkeliagveeeglha
rvvrilrtsdvsfmawdaanlsgsgigigiqskgttvihqrdllplsnlelfsqaplltl
etyrqigknaaryarkespspvpvvndqmvrpkfmakaalfhiketkhvvqdaepvtlhi
dlvr

SCOPe Domain Coordinates for d1mmfe_:

Click to download the PDB-style file with coordinates for d1mmfe_.
(The format of our PDB-style files is described here.)

Timeline for d1mmfe_: