SCOPe 2.06: Domain d1mm9a_: 1mm9 A:

Lineage for d1mm9a_ (1mm9 A:)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.61: Streptavidin-like [50875] (8 superfamilies)
   barrel, closed; n=8, S=10; meander

4. Superfamily b.61.1: Avidin/streptavidin [50876] (2 families)

5. Family b.61.1.1: Avidin/streptavidin [50877] (3 proteins)

6. Protein Streptavidin [50878] (1 species)

7. Species Streptomyces avidinii [TaxId:1895] [50879] (125 PDB entries)

8. Domain d1mm9a_: 1mm9 A: [85017]
   mutant with insertion of fibronectin hexapeptide, including rgd
   complexed with mrd; mutant

Details for d1mm9a_

PDB Entry: 1mm9, 1.66 Å

PDB Description: Streptavidin Mutant with Insertion of Fibronectin Hexapeptide, including RGD

PDB Compounds: (A:) streptavidin

SCOPe Domain Sequences for d1mm9a_:

Sequence; same for both SEQRES and ATOM records:

>d1mm9a_ b.61.1.1 (A:) Streptavidin {Streptomyces avidinii [TaxId: 1895]}
gitgtwynqlgstfivtagadgaltgtyesavgnaesryvltgrydsapgrgdspgsgta
lgwtvawknnyrnahsattwsgqyvggaearintqwlltsgtteanawkstlvghdtftk
vkpsaas

Timeline for d1mm9a_:

• d1mm9a_ first appeared in SCOP 1.65
  
• d1mm9a_ appears in SCOPe 2.05
  
• d1mm9a_ appears in SCOPe 2.07
  
• d1mm9a_ appears in the current release, SCOPe 2.08