Lineage for d1mm3a_ (1mm3 A:)

  1. Root: SCOP 1.71
  2. 621190Class g: Small proteins [56992] (79 folds)
  3. 625240Fold g.50: FYVE/PHD zinc finger [57902] (1 superfamily)
    dimetal(zinc)-bound alpha+beta fold
  4. 625241Superfamily g.50.1: FYVE/PHD zinc finger [57903] (3 families) (S)
  5. 625264Family g.50.1.2: PHD domain [57911] (12 proteins)
  6. 625272Protein Mi2-beta (CHD4) [90226] (1 species)
    chromodomain-helicase-DNA-binding protein 4
  7. 625273Species Human (Homo sapiens) [TaxId:9606] [90227] (2 PDB entries)
  8. 625274Domain d1mm3a_: 1mm3 A: [85016]
    second PHD domain with the C-terminal loop replaced by the corresponding loop from WSTF
    complexed with zn

Details for d1mm3a_

PDB Entry: 1mm3 (more details)

PDB Description: solution structure of the 2nd phd domain from mi2b with c-terminal loop replaced by corresponding loop from wstf

SCOP Domain Sequences for d1mm3a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1mm3a_ g.50.1.2 (A:) Mi2-beta (CHD4) {Human (Homo sapiens)}
gplgsdhhmefcrvckdggellccdtcpssyhihclrpalyevpdgewqcprctcpalkg
k

SCOP Domain Coordinates for d1mm3a_:

Click to download the PDB-style file with coordinates for d1mm3a_.
(The format of our PDB-style files is described here.)

Timeline for d1mm3a_: