Class g: Small proteins [56992] (79 folds) |
Fold g.50: FYVE/PHD zinc finger [57902] (1 superfamily) dimetal(zinc)-bound alpha+beta fold |
Superfamily g.50.1: FYVE/PHD zinc finger [57903] (3 families) |
Family g.50.1.2: PHD domain [57911] (12 proteins) |
Protein Mi2-beta (CHD4) [90226] (1 species) chromodomain-helicase-DNA-binding protein 4 |
Species Human (Homo sapiens) [TaxId:9606] [90227] (2 PDB entries) |
Domain d1mm3a_: 1mm3 A: [85016] second PHD domain with the C-terminal loop replaced by the corresponding loop from WSTF complexed with zn |
PDB Entry: 1mm3 (more details)
SCOP Domain Sequences for d1mm3a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1mm3a_ g.50.1.2 (A:) Mi2-beta (CHD4) {Human (Homo sapiens)} gplgsdhhmefcrvckdggellccdtcpssyhihclrpalyevpdgewqcprctcpalkg k
Timeline for d1mm3a_: