Lineage for d1mm2a_ (1mm2 A:)

  1. Root: SCOPe 2.05
  2. 1959977Class g: Small proteins [56992] (92 folds)
  3. 1967224Fold g.50: FYVE/PHD zinc finger [57902] (1 superfamily)
    dimetal(zinc)-bound alpha+beta fold
  4. 1967225Superfamily g.50.1: FYVE/PHD zinc finger [57903] (4 families) (S)
  5. 1967248Family g.50.1.2: PHD domain [57911] (14 proteins)
  6. 1967260Protein Mi2-beta (CHD4) [90226] (1 species)
    chromodomain-helicase-DNA-binding protein 4
  7. 1967261Species Human (Homo sapiens) [TaxId:9606] [90227] (3 PDB entries)
  8. 1967264Domain d1mm2a_: 1mm2 A: [85015]
    second PHD domain
    complexed with zn

Details for d1mm2a_

PDB Entry: 1mm2 (more details)

PDB Description: solution structure of the 2nd phd domain from mi2b
PDB Compounds: (A:) Mi2-beta

SCOPe Domain Sequences for d1mm2a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1mm2a_ g.50.1.2 (A:) Mi2-beta (CHD4) {Human (Homo sapiens) [TaxId: 9606]}
gplgsdhhmefcrvckdggellccdtcpssyhihclnpplpeipngewlcprctcpalkg
k

SCOPe Domain Coordinates for d1mm2a_:

Click to download the PDB-style file with coordinates for d1mm2a_.
(The format of our PDB-style files is described here.)

Timeline for d1mm2a_: