| Class c: Alpha and beta proteins (a/b) [51349] (130 folds) |
| Fold c.47: Thioredoxin fold [52832] (2 superfamilies) core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest |
Superfamily c.47.1: Thioredoxin-like [52833] (14 families) ![]() |
| Family c.47.1.5: Glutathione S-transferase (GST), N-terminal domain [52862] (16 proteins) |
| Protein Class alpha GST [81360] (8 species) |
| Species Mouse (Mus musculus), (a2-2) [TaxId:10090] [89703] (1 PDB entry) |
| Domain d1ml6b2: 1ml6 B:302-379 [85012] Other proteins in same PDB: d1ml6a1, d1ml6b1 complexed with cso, gbx, ioh |
PDB Entry: 1ml6 (more details), 1.9 Å
SCOP Domain Sequences for d1ml6b2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ml6b2 c.47.1.5 (B:302-379) Class alpha GST {Mouse (Mus musculus), (a2-2)}
gkpvlhyfnargrmecirwllaaagvefeekfiqspedleklkkdgnlmfdqvpmveidg
mklvqtrailnyiatkyd
Timeline for d1ml6b2: