Lineage for d1ml6b2 (1ml6 B:302-379)

  1. Root: SCOP 1.67
  2. 383641Class c: Alpha and beta proteins (a/b) [51349] (130 folds)
  3. 395822Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
  4. 395823Superfamily c.47.1: Thioredoxin-like [52833] (14 families) (S)
  5. 395996Family c.47.1.5: Glutathione S-transferase (GST), N-terminal domain [52862] (16 proteins)
  6. 396007Protein Class alpha GST [81360] (8 species)
  7. 396060Species Mouse (Mus musculus), (a2-2) [TaxId:10090] [89703] (1 PDB entry)
  8. 396062Domain d1ml6b2: 1ml6 B:302-379 [85012]
    Other proteins in same PDB: d1ml6a1, d1ml6b1
    complexed with cso, gbx, ioh

Details for d1ml6b2

PDB Entry: 1ml6 (more details), 1.9 Å

PDB Description: Crystal Structure of mGSTA2-2 in Complex with the Glutathione Conjugate of Benzo[a]pyrene-7(R),8(S)-Diol-9(S),10(R)-Epoxide

SCOP Domain Sequences for d1ml6b2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ml6b2 c.47.1.5 (B:302-379) Class alpha GST {Mouse (Mus musculus), (a2-2)}
gkpvlhyfnargrmecirwllaaagvefeekfiqspedleklkkdgnlmfdqvpmveidg
mklvqtrailnyiatkyd

SCOP Domain Coordinates for d1ml6b2:

Click to download the PDB-style file with coordinates for d1ml6b2.
(The format of our PDB-style files is described here.)

Timeline for d1ml6b2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1ml6b1