Lineage for d1ml6a2 (1ml6 A:2-79)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2876126Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
  4. 2876127Superfamily c.47.1: Thioredoxin-like [52833] (24 families) (S)
  5. 2876589Family c.47.1.5: Glutathione S-transferase (GST), N-terminal domain [52862] (19 proteins)
  6. 2876600Protein Class alpha GST [81360] (8 species)
  7. 2876733Species Mouse (Mus musculus), (a2-2) [TaxId:10090] [89703] (1 PDB entry)
  8. 2876734Domain d1ml6a2: 1ml6 A:2-79 [85010]
    Other proteins in same PDB: d1ml6a1, d1ml6b1
    complexed with gbx, ipa

Details for d1ml6a2

PDB Entry: 1ml6 (more details), 1.9 Å

PDB Description: Crystal Structure of mGSTA2-2 in Complex with the Glutathione Conjugate of Benzo[a]pyrene-7(R),8(S)-Diol-9(S),10(R)-Epoxide
PDB Compounds: (A:) Glutathione S-Transferase GT41A

SCOPe Domain Sequences for d1ml6a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ml6a2 c.47.1.5 (A:2-79) Class alpha GST {Mouse (Mus musculus), (a2-2) [TaxId: 10090]}
gkpvlhyfnargrmecirwllaaagvefeekfiqspedleklkkdgnlmfdqvpmveidg
mklvqtrailnyiatkyd

SCOPe Domain Coordinates for d1ml6a2:

Click to download the PDB-style file with coordinates for d1ml6a2.
(The format of our PDB-style files is described here.)

Timeline for d1ml6a2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1ml6a1