Lineage for d1ml6a1 (1ml6 A:80-221)

  1. Root: SCOP 1.65
  2. 275720Class a: All alpha proteins [46456] (179 folds)
  3. 281527Fold a.45: Glutathione S-transferase (GST), C-terminal domain [47615] (1 superfamily)
    core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix
  4. 281528Superfamily a.45.1: Glutathione S-transferase (GST), C-terminal domain [47616] (1 family) (S)
    this domains follows the thioredoxin-like N-terminal domain
  5. 281529Family a.45.1.1: Glutathione S-transferase (GST), C-terminal domain [47617] (15 proteins)
  6. 281538Protein Class alpha GST [81349] (8 species)
  7. 281591Species Mouse (Mus musculus), (a2-2) [TaxId:10090] [89059] (1 PDB entry)
  8. 281592Domain d1ml6a1: 1ml6 A:80-221 [85009]
    Other proteins in same PDB: d1ml6a2, d1ml6b2

Details for d1ml6a1

PDB Entry: 1ml6 (more details), 1.9 Å

PDB Description: Crystal Structure of mGSTA2-2 in Complex with the Glutathione Conjugate of Benzo[a]pyrene-7(R),8(S)-Diol-9(S),10(R)-Epoxide

SCOP Domain Sequences for d1ml6a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ml6a1 a.45.1.1 (A:80-221) Class alpha GST {Mouse (Mus musculus), (a2-2)}
lygkdmkeralidmytegildltemigqlvlcppdqreaktalakdrtknrylpafekvl
kshgqdylvgnrltrvdvhllelllyveeldaslltpfpllkafksrisslpnvkkflqp
gsqrkppldakqieearkvfkf

SCOP Domain Coordinates for d1ml6a1:

Click to download the PDB-style file with coordinates for d1ml6a1.
(The format of our PDB-style files is described here.)

Timeline for d1ml6a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1ml6a2