Class d: Alpha and beta proteins (a+b) [53931] (381 folds) |
Fold d.81: FwdE/GAPDH domain-like [55346] (4 superfamilies) core: alpha-beta-alpha-beta(3); mixed sheet: 2134, strand 2 is parallel to strand 1 |
Superfamily d.81.1: Glyceraldehyde-3-phosphate dehydrogenase-like, C-terminal domain [55347] (5 families) N-terminal domain is the classic Rossmann-fold |
Family d.81.1.1: GAPDH-like [55348] (6 proteins) has many additional secondary structures |
Protein Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) [55349] (19 species) |
Species Trypanosoma cruzi [TaxId:5693] [75483] (5 PDB entries) |
Domain d1ml3d2: 1ml3 D:165-333 [85008] Other proteins in same PDB: d1ml3a1, d1ml3b1, d1ml3c1, d1ml3d1 complexed with cyx, nad |
PDB Entry: 1ml3 (more details), 2.5 Å
SCOPe Domain Sequences for d1ml3d2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ml3d2 d.81.1.1 (D:165-333) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Trypanosoma cruzi [TaxId: 5693]} scttnclapivhvlvkegfgvqtglmttihsytatqktvdgvsvkdwrggraaavniips ttgaakavgmvipstqgkltgmsfrvptpdvsvvdltftaardtsiqeidaalkraskty mkgilgytdeelvsadfindnrssiydskatlqnnlpkerrffkivswy
Timeline for d1ml3d2: