Lineage for d1ml3c2 (1ml3 C:165-333)

  1. Root: SCOP 1.65
  2. 323018Class d: Alpha and beta proteins (a+b) [53931] (234 folds)
  3. 331066Fold d.81: Glyceraldehyde-3-phosphate dehydrogenase-like, C-terminal domain [55346] (1 superfamily)
    core: alpha-beta-alpha-beta(3); mixed sheet: 2134, strand 2 is parallel to strand 1
  4. 331067Superfamily d.81.1: Glyceraldehyde-3-phosphate dehydrogenase-like, C-terminal domain [55347] (5 families) (S)
    N-terminal domain is the classic Rossmann-fold
  5. 331068Family d.81.1.1: GAPDH-like [55348] (3 proteins)
    has many additional secondary structures
  6. 331086Protein Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) [55349] (14 species)
  7. 331224Species Trypanosoma cruzi [TaxId:5693] [75483] (2 PDB entries)
  8. 331231Domain d1ml3c2: 1ml3 C:165-333 [85006]
    Other proteins in same PDB: d1ml3a1, d1ml3b1, d1ml3c1, d1ml3d1

Details for d1ml3c2

PDB Entry: 1ml3 (more details), 2.5 Å

PDB Description: Evidences for a flip-flop catalytic mechanism of Trypanosoma cruzi glyceraldehyde-3-phosphate dehydrogenase, from its crystal structure in complex with reacted irreversible inhibitor 2-(2-phosphono-ethyl)-acrylic acid 4-nitro-phenyl ester

SCOP Domain Sequences for d1ml3c2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ml3c2 d.81.1.1 (C:165-333) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Trypanosoma cruzi}
scttnclapivhvlvkegfgvqtglmttihsytatqktvdgvsvkdwrggraaavniips
ttgaakavgmvipstqgkltgmsfrvptpdvsvvdltftaardtsiqeidaalkraskty
mkgilgytdeelvsadfindnrssiydskatlqnnlpkerrffkivswy

SCOP Domain Coordinates for d1ml3c2:

Click to download the PDB-style file with coordinates for d1ml3c2.
(The format of our PDB-style files is described here.)

Timeline for d1ml3c2: