Lineage for d1ml3c1 (1ml3 C:1-164,C:334-359)

  1. Root: SCOP 1.65
  2. 305035Class c: Alpha and beta proteins (a/b) [51349] (121 folds)
  3. 307887Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 307888Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (10 families) (S)
  5. 308470Family c.2.1.3: Glyceraldehyde-3-phosphate dehydrogenase-like, N-terminal domain [51800] (13 proteins)
    family members also share a common alpha+beta fold in C-terminal domain
  6. 308576Protein Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) [51801] (14 species)
  7. 308714Species Trypanosoma cruzi [TaxId:5693] [75104] (2 PDB entries)
  8. 308721Domain d1ml3c1: 1ml3 C:1-164,C:334-359 [85005]
    Other proteins in same PDB: d1ml3a2, d1ml3b2, d1ml3c2, d1ml3d2

Details for d1ml3c1

PDB Entry: 1ml3 (more details), 2.5 Å

PDB Description: Evidences for a flip-flop catalytic mechanism of Trypanosoma cruzi glyceraldehyde-3-phosphate dehydrogenase, from its crystal structure in complex with reacted irreversible inhibitor 2-(2-phosphono-ethyl)-acrylic acid 4-nitro-phenyl ester

SCOP Domain Sequences for d1ml3c1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ml3c1 c.2.1.3 (C:1-164,C:334-359) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Trypanosoma cruzi}
mpikvgingfgrigrmvfqalcedgllgteidvvavvdmntdaeyfayqmrydtvhgkfk
yevtttksspsvakddtlvvnghrilcvkaqrnpadlpwgklgveyviestglftakaaa
eghlrggarkvvisapasggaktlvmgvnhheynpsehhvvsnaXdnewgyshrvvdlvr
hmaskdrsarl

SCOP Domain Coordinates for d1ml3c1:

Click to download the PDB-style file with coordinates for d1ml3c1.
(The format of our PDB-style files is described here.)

Timeline for d1ml3c1: