Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily) core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456 The nucleotide-binding modes of this and the next two folds/superfamilies are similar |
Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) |
Family c.2.1.3: Glyceraldehyde-3-phosphate dehydrogenase-like, N-terminal domain [51800] (22 proteins) family members also share a common alpha+beta fold in C-terminal domain |
Protein Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) [51801] (21 species) |
Species Trypanosoma cruzi [TaxId:5693] [75104] (5 PDB entries) |
Domain d1ml3b1: 1ml3 B:1-164,B:334-359 [85003] Other proteins in same PDB: d1ml3a2, d1ml3b2, d1ml3c2, d1ml3d2 complexed with cyx, nad |
PDB Entry: 1ml3 (more details), 2.5 Å
SCOPe Domain Sequences for d1ml3b1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ml3b1 c.2.1.3 (B:1-164,B:334-359) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Trypanosoma cruzi [TaxId: 5693]} mpikvgingfgrigrmvfqalcedgllgteidvvavvdmntdaeyfayqmrydtvhgkfk yevtttksspsvakddtlvvnghrilcvkaqrnpadlpwgklgveyviestglftakaaa eghlrggarkvvisapasggaktlvmgvnhheynpsehhvvsnaXdnewgyshrvvdlvr hmaskdrsarl
Timeline for d1ml3b1: