Lineage for d1ml3a1 (1ml3 A:1-164,A:334-359)

  1. Root: SCOPe 2.04
  2. 1565955Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1576363Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 1576364Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 1578283Family c.2.1.3: Glyceraldehyde-3-phosphate dehydrogenase-like, N-terminal domain [51800] (22 proteins)
    family members also share a common alpha+beta fold in C-terminal domain
  6. 1578524Protein Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) [51801] (19 species)
  7. 1578722Species Trypanosoma cruzi [TaxId:5693] [75104] (5 PDB entries)
  8. 1578735Domain d1ml3a1: 1ml3 A:1-164,A:334-359 [85001]
    Other proteins in same PDB: d1ml3a2, d1ml3b2, d1ml3c2, d1ml3d2
    complexed with cyx, nad

Details for d1ml3a1

PDB Entry: 1ml3 (more details), 2.5 Å

PDB Description: Evidences for a flip-flop catalytic mechanism of Trypanosoma cruzi glyceraldehyde-3-phosphate dehydrogenase, from its crystal structure in complex with reacted irreversible inhibitor 2-(2-phosphono-ethyl)-acrylic acid 4-nitro-phenyl ester
PDB Compounds: (A:) Glyceraldehyde 3-phosphate dehydrogenase, glycosomal

SCOPe Domain Sequences for d1ml3a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ml3a1 c.2.1.3 (A:1-164,A:334-359) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Trypanosoma cruzi [TaxId: 5693]}
mpikvgingfgrigrmvfqalcedgllgteidvvavvdmntdaeyfayqmrydtvhgkfk
yevtttksspsvakddtlvvnghrilcvkaqrnpadlpwgklgveyviestglftakaaa
eghlrggarkvvisapasggaktlvmgvnhheynpsehhvvsnaXdnewgyshrvvdlvr
hmaskdrsarl

SCOPe Domain Coordinates for d1ml3a1:

Click to download the PDB-style file with coordinates for d1ml3a1.
(The format of our PDB-style files is described here.)

Timeline for d1ml3a1: