Lineage for d1mkdl_ (1mkd L:)

  1. Root: SCOP 1.73
  2. 631650Class a: All alpha proteins [46456] (258 folds)
  3. 651135Fold a.211: HD-domain/PDEase-like [109603] (1 superfamily)
    multihelical; consists of two different alpha-helical bundles
  4. 651136Superfamily a.211.1: HD-domain/PDEase-like [109604] (5 families) (S)
  5. 651168Family a.211.1.2: PDEase [48548] (6 proteins)
    Pfam PF00233; multihelical; can be divided into three subdomains
  6. 651201Protein Catalytic domain of cyclic nucleotide phosphodiesterase pde4d [89151] (1 species)
  7. 651202Species Human (Homo sapiens) [TaxId:9606] [89152] (20 PDB entries)
  8. 651264Domain d1mkdl_: 1mkd L: [84993]
    complexed with mg, zar, zn

Details for d1mkdl_

PDB Entry: 1mkd (more details), 2.9 Å

PDB Description: crystal structure of PDE4D catalytic domain and zardaverine complex
PDB Compounds: (L:) Phosphodiesterase 4D

SCOP Domain Sequences for d1mkdl_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1mkdl_ a.211.1.2 (L:) Catalytic domain of cyclic nucleotide phosphodiesterase pde4d {Human (Homo sapiens) [TaxId: 9606]}
teqedvlakeledvnkwglhvfriaelsgnrpltvimhtifqerdllktfkipvdtlity
lmtledhyhadvayhnnihaadvvqsthvllstpaleavftdleilaaifasaihdvdhp
gvsnqflintnselalmyndssvlenhhlavgfkllqeencdifqnltkkqrqslrkmvi
divlatdmskhmnlladlktmvetkkvtssgvllldnysdriqvlqnmvhcadlsnptkp
lqlyrqwtdrimeeffpqgdrerergmeispmcdkhnasveksqvgfidyivhplwetwa
dlvhpdaqdildtlednrewyqstipqs

SCOP Domain Coordinates for d1mkdl_:

Click to download the PDB-style file with coordinates for d1mkdl_.
(The format of our PDB-style files is described here.)

Timeline for d1mkdl_: