Lineage for d1mkdg_ (1mkd G:)

  1. Root: SCOP 1.69
  2. 436025Class a: All alpha proteins [46456] (218 folds)
  3. 450552Fold a.211: HD-domain/PDEase-like [109603] (1 superfamily)
    multihelical; consists of two different alpha-helical bundles
  4. 450553Superfamily a.211.1: HD-domain/PDEase-like [109604] (2 families) (S)
  5. 450559Family a.211.1.2: PDEase [48548] (6 proteins)
    multihelical; can be divided into three subdomains
    3',5'-cyclic-nucleotide phosphodiesterase, Pfam 00233
  6. 450569Protein Catalytic domain of cyclic nucleotide phosphodiesterase pde4d [89151] (1 species)
  7. 450570Species Human (Homo sapiens) [TaxId:9606] [89152] (7 PDB entries)
  8. 450597Domain d1mkdg_: 1mkd G: [84988]

Details for d1mkdg_

PDB Entry: 1mkd (more details), 2.9 Å

PDB Description: crystal structure of PDE4D catalytic domain and zardaverine complex

SCOP Domain Sequences for d1mkdg_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1mkdg_ a.211.1.2 (G:) Catalytic domain of cyclic nucleotide phosphodiesterase pde4d {Human (Homo sapiens)}
teqedvlakeledvnkwglhvfriaelsgnrpltvimhtifqerdllktfkipvdtlity
lmtledhyhadvayhnnihaadvvqsthvllstpaleavftdleilaaifasaihdvdhp
gvsnqflintnselalmyndssvlenhhlavgfkllqeencdifqnltkkqrqslrkmvi
divlatdmskhmnlladlktmvetkkvtssgvllldnysdriqvlqnmvhcadlsnptkp
lqlyrqwtdrimeeffpqgdrerergmeispmcdkhnasveksqvgfidyivhplwetwa
dlvhpdaqdildtlednrewyqstipqs

SCOP Domain Coordinates for d1mkdg_:

Click to download the PDB-style file with coordinates for d1mkdg_.
(The format of our PDB-style files is described here.)

Timeline for d1mkdg_: