Lineage for d1mkdb_ (1mkd B:)

  1. Root: SCOP 1.71
  2. 530466Class a: All alpha proteins [46456] (226 folds)
  3. 546038Fold a.211: HD-domain/PDEase-like [109603] (1 superfamily)
    multihelical; consists of two different alpha-helical bundles
  4. 546039Superfamily a.211.1: HD-domain/PDEase-like [109604] (3 families) (S)
  5. 546057Family a.211.1.2: PDEase [48548] (6 proteins)
    Pfam 00233; multihelical; can be divided into three subdomains
  6. 546090Protein Catalytic domain of cyclic nucleotide phosphodiesterase pde4d [89151] (1 species)
  7. 546091Species Human (Homo sapiens) [TaxId:9606] [89152] (11 PDB entries)
  8. 546121Domain d1mkdb_: 1mkd B: [84983]

Details for d1mkdb_

PDB Entry: 1mkd (more details), 2.9 Å

PDB Description: crystal structure of PDE4D catalytic domain and zardaverine complex

SCOP Domain Sequences for d1mkdb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1mkdb_ a.211.1.2 (B:) Catalytic domain of cyclic nucleotide phosphodiesterase pde4d {Human (Homo sapiens)}
teqedvlakeledvnkwglhvfriaelsgnrpltvimhtifqerdllktfkipvdtlity
lmtledhyhadvayhnnihaadvvqsthvllstpaleavftdleilaaifasaihdvdhp
gvsnqflintnselalmyndssvlenhhlavgfkllqeencdifqnltkkqrqslrkmvi
divlatdmskhmnlladlktmvetkkvtssgvllldnysdriqvlqnmvhcadlsnptkp
lqlyrqwtdrimeeffpqgdrerergmeispmcdkhnasveksqvgfidyivhplwetwa
dlvhpdaqdildtlednrewyqstipqs

SCOP Domain Coordinates for d1mkdb_:

Click to download the PDB-style file with coordinates for d1mkdb_.
(The format of our PDB-style files is described here.)

Timeline for d1mkdb_: