SCOPe 2.07: Domain d1mk3a1: 1mk3 A:1-170

Lineage for d1mk3a1 (1mk3 A:1-170)

1. Root: SCOPe 2.07

2. Class f: Membrane and cell surface proteins and peptides [56835] (60 folds)

3. Fold f.1: Toxins' membrane translocation domains [56836] (5 superfamilies)
   multi-helical domains of various folds which is thought to unfold in the membrane

4. Superfamily f.1.4: Bcl-2 inhibitors of programmed cell death [56854] (2 families)
   PROVISIONAL CLASSIFICATION, based on structural similarity to the diphtheria toxin domain

5. Family f.1.4.1: Bcl-2 inhibitors of programmed cell death [56855] (11 proteins)
   Pfam PF00452

6. Protein Apoptosis regulator Bcl-w [90103] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [90104] (3 PDB entries)

8. Domain d1mk3a1: 1mk3 A:1-170 [84978]
   Other proteins in same PDB: d1mk3a2

Details for d1mk3a1

PDB Entry: 1mk3

PDB Description: solution structure of human bcl-w protein

PDB Compounds: (A:) Apoptosis regulator Bcl-W

SCOPe Domain Sequences for d1mk3a1:

Sequence; same for both SEQRES and ATOM records:

>d1mk3a1 f.1.4.1 (A:1-170) Apoptosis regulator Bcl-w {Human (Homo sapiens) [TaxId: 9606]}
atpasapdtralvadfvgyklrqkgyvcgagpgegpaadplhqamraagdefetrfrrtf
sdlaaqlhvtpgsaqqrftqvsdelfqggpnwgrlvaffvfgaalcaesvnkemevlvgq
vqewmvayletrladwihssggwaeftalygdgaleearrlregnwasvr

Timeline for d1mk3a1:

• d1mk3a1 first appeared in SCOP 1.65, called d1mk3a_
  
• d1mk3a1 appears in SCOPe 2.06
  
• d1mk3a1 appears in the current release, SCOPe 2.08