Lineage for d1mjda1 (1mjd A:45-150)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2501110Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 2504283Superfamily d.15.11: Doublecortin (DC) [89837] (1 family) (S)
    possibly related to the ubiquitin-like superfamily
  5. 2504284Family d.15.11.1: Doublecortin (DC) [89838] (3 protein domains)
  6. 2504285Protein Doublecortin [89841] (1 species)
    duplication: contains tandem repeat of two DC domains
  7. 2504286Species Human (Homo sapiens) [TaxId:9606] [89842] (1 PDB entry)
  8. 2504287Domain d1mjda1: 1mjd A:45-150 [84977]
    Other proteins in same PDB: d1mjda2
    N-terminal DC domain

Details for d1mjda1

PDB Entry: 1mjd (more details)

PDB Description: Structure of N-terminal domain of human doublecortin
PDB Compounds: (A:) doublecortin

SCOPe Domain Sequences for d1mjda1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1mjda1 d.15.11.1 (A:45-150) Doublecortin {Human (Homo sapiens) [TaxId: 9606]}
alsnekkakkvrfyrngdryfkgivyavssdrfrsfdalladltrslsdninlpqgvryi
ytidgsrkigsmdeleegesyvcssdnffkkveytknvnpnwsvnv

SCOPe Domain Coordinates for d1mjda1:

Click to download the PDB-style file with coordinates for d1mjda1.
(The format of our PDB-style files is described here.)

Timeline for d1mjda1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1mjda2