SCOPe 2.07: Domain d1mihb_: 1mih B:

Lineage for d1mihb_ (1mih B:)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
   3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345

4. Superfamily c.23.1: CheY-like [52172] (8 families)

5. Family c.23.1.1: CheY-related [52173] (26 proteins)

6. Protein CheY protein [52174] (5 species)

7. Species Escherichia coli [TaxId:562] [52175] (42 PDB entries)
   Uniprot P06143

8. Domain d1mihb_: 1mih B: [84976]
   complexed with bef, mn, so4

Details for d1mihb_

PDB Entry: 1mih, 2.7 Å

PDB Description: a role for chey glu 89 in chez-mediated dephosphorylation of the e. coli chemotaxis response regulator chey

PDB Compounds: (B:) Chemotaxis protein cheY

SCOPe Domain Sequences for d1mihb_:

Sequence; same for both SEQRES and ATOM records:

>d1mihb_ c.23.1.1 (B:) CheY protein {Escherichia coli [TaxId: 562]}
adkelkflvvddfstmrrivrnllkelgfnnveeaedgvdalnklqaggygfvisdwrmp
nmdglellktiradgamsalpvlmvtaeakkeniiaaaqagasgyvvkpftaatleekln
kifeklgm

Timeline for d1mihb_:

• d1mihb_ first appeared in SCOP 1.65
  
• d1mihb_ appears in SCOPe 2.06
  
• d1mihb_ appears in the current release, SCOPe 2.08