Lineage for d1miha_ (1mih A:)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2114715Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. 2114716Superfamily c.23.1: CheY-like [52172] (8 families) (S)
  5. 2114717Family c.23.1.1: CheY-related [52173] (26 proteins)
  6. 2114728Protein CheY protein [52174] (5 species)
  7. 2114729Species Escherichia coli [TaxId:562] [52175] (42 PDB entries)
    Uniprot P06143
  8. 2114790Domain d1miha_: 1mih A: [84975]
    complexed with bef, mn, so4

Details for d1miha_

PDB Entry: 1mih (more details), 2.7 Å

PDB Description: a role for chey glu 89 in chez-mediated dephosphorylation of the e. coli chemotaxis response regulator chey
PDB Compounds: (A:) Chemotaxis protein cheY

SCOPe Domain Sequences for d1miha_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1miha_ c.23.1.1 (A:) CheY protein {Escherichia coli [TaxId: 562]}
adkelkflvvddfstmrrivrnllkelgfnnveeaedgvdalnklqaggygfvisdwrmp
nmdglellktiradgamsalpvlmvtaeakkeniiaaaqagasgyvvkpftaatleekln
kifeklgm

SCOPe Domain Coordinates for d1miha_:

Click to download the PDB-style file with coordinates for d1miha_.
(The format of our PDB-style files is described here.)

Timeline for d1miha_: