Lineage for d1miha_ (1mih A:)
- Root: SCOP 1.65
Class c: Alpha and beta proteins (a/b) [51349] (121 folds) 
Fold c.23: Flavodoxin-like [52171] (16 superfamilies)
3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
Superfamily c.23.1: CheY-like [52172] (5 families) 
Family c.23.1.1: CheY-related [52173] (13 proteins) Protein CheY protein [52174] (3 species) Species Escherichia coli [TaxId:562] [52175] (30 PDB entries) 
Domain d1miha_: 1mih A: [84975]
Details for d1miha_
PDB Entry: 1mih (more details), 2.7 Å
PDB Description: a role for chey glu 89 in chez-mediated dephosphorylation of the e. coli chemotaxis response regulator chey
SCOP Domain Sequences for d1miha_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1miha_ c.23.1.1 (A:) CheY protein {Escherichia coli}
adkelkflvvddfstmrrivrnllkelgfnnveeaedgvdalnklqaggygfvisdwrmp
nmdglellktiradgamsalpvlmvtaeakkeniiaaaqagasgyvvkpftaatleekln
kifeklgm
SCOP Domain Coordinates for d1miha_:
Click to download the PDB-style file with coordinates for d1miha_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1miha_:
- d1miha_ is new in SCOP 1.65
- d1miha_ appears in SCOP 1.67
- d1miha_ appears in the current release, SCOPe 2.08
View in 3D
