SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d1miha_ (1mih A:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2101600Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. 2101601Superfamily c.23.1: CheY-like [52172] (8 families) (S)
  5. 2101602Family c.23.1.1: CheY-related [52173] (26 protein domains)
  6. 2101613Protein CheY protein [52174] (5 species)
  7. 2101614Species Escherichia coli [TaxId:562] [52175] (42 PDB entries)
    Uniprot P06143
  8. 2101675Domain d1miha_: 1mih A: [84975]
    complexed with bef, mn, so4

Details for d1miha_

PDB Entry: 1mih (more details), 2.7 Å

PDB Description: a role for chey glu 89 in chez-mediated dephosphorylation of the e. coli chemotaxis response regulator chey
PDB Compounds: (A:) Chemotaxis protein cheY

SCOPe Domain Sequences for d1miha_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1miha_ c.23.1.1 (A:) CheY protein {Escherichia coli [TaxId: 562]}
adkelkflvvddfstmrrivrnllkelgfnnveeaedgvdalnklqaggygfvisdwrmp
nmdglellktiradgamsalpvlmvtaeakkeniiaaaqagasgyvvkpftaatleekln
kifeklgm

SCOPe Domain Coordinates for d1miha_:

Click to download the PDB-style file with coordinates for d1miha_.
(The format of our PDB-style files is described here.)

Timeline for d1miha_: