Lineage for d1mhqb_ (1mhq B:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2009599Fold a.118: alpha-alpha superhelix [48370] (25 superfamilies)
    multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix
  4. 2010991Superfamily a.118.9: ENTH/VHS domain [48464] (5 families) (S)
  5. 2011006Family a.118.9.2: VHS domain [48468] (6 proteins)
  6. 2011020Protein ADP-ribosylation factor binding protein Gga2 [89134] (1 species)
  7. 2011021Species Human (Homo sapiens) [TaxId:9606] [89135] (1 PDB entry)
  8. 2011023Domain d1mhqb_: 1mhq B: [84974]

Details for d1mhqb_

PDB Entry: 1mhq (more details), 2.2 Å

PDB Description: crystal structure of human gga2 vhs domain
PDB Compounds: (B:) ADP-ribosylation factor binding protein GGA2

SCOPe Domain Sequences for d1mhqb_:

Sequence, based on SEQRES records: (download)

>d1mhqb_ a.118.9.2 (B:) ADP-ribosylation factor binding protein Gga2 {Human (Homo sapiens) [TaxId: 9606]}
slelwlnkatdpsmseqdwsaiqnfceqvntdpngpthapwllahkiqspqekealyalt
vlemcmnhcgekfhsevakfrflnelikvlspkylgswatgkvkgrvieilfswtvwfpe
dikirdayqmlkkqgiikqdpklpvd

Sequence, based on observed residues (ATOM records): (download)

>d1mhqb_ a.118.9.2 (B:) ADP-ribosylation factor binding protein Gga2 {Human (Homo sapiens) [TaxId: 9606]}
slelwlnkatdpsmseqdwsaiqnfceqvntdpngpthapwllahkiqspqekealyalt
vlemcmnhcgekfhsevakfrflnelikvlsplgswatgkvkgrvieilfswtvwfpedi
kirdayqmlkkqgiikqdpklpvd

SCOPe Domain Coordinates for d1mhqb_:

Click to download the PDB-style file with coordinates for d1mhqb_.
(The format of our PDB-style files is described here.)

Timeline for d1mhqb_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1mhqa_