Lineage for d1mhqb_ (1mhq B:)
- Root: SCOP 1.65
Class a: All alpha proteins [46456] (179 folds) 
Fold a.118: alpha-alpha superhelix [48370] (17 superfamilies)
multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix
Superfamily a.118.9: ENTH/VHS domain [48464] (2 families) 
Family a.118.9.2: VHS domain [48468] (5 proteins) 
Protein ADP-ribosylation factor binding protein Gga2 [89134] (1 species) Species Human (Homo sapiens) [TaxId:9606] [89135] (1 PDB entry) 
Domain d1mhqb_: 1mhq B: [84974]
Details for d1mhqb_
PDB Entry: 1mhq (more details), 2.2 Å
PDB Description: crystal structure of human gga2 vhs domain
SCOP Domain Sequences for d1mhqb_:
Sequence, based on SEQRES records: (download)
>d1mhqb_ a.118.9.2 (B:) ADP-ribosylation factor binding protein Gga2 {Human (Homo sapiens)}
slelwlnkatdpsmseqdwsaiqnfceqvntdpngpthapwllahkiqspqekealyalt
vlemcmnhcgekfhsevakfrflnelikvlspkylgswatgkvkgrvieilfswtvwfpe
dikirdayqmlkkqgiikqdpklpvd
Sequence, based on observed residues (ATOM records): (download)
>d1mhqb_ a.118.9.2 (B:) ADP-ribosylation factor binding protein Gga2 {Human (Homo sapiens)}
slelwlnkatdpsmseqdwsaiqnfceqvntdpngpthapwllahkiqspqekealyalt
vlemcmnhcgekfhsevakfrflnelikvlsplgswatgkvkgrvieilfswtvwfpedi
kirdayqmlkkqgiikqdpklpvd
SCOP Domain Coordinates for d1mhqb_:
Click to download the PDB-style file with coordinates for d1mhqb_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1mhqb_:
- d1mhqb_ is new in SCOP 1.65
- d1mhqb_ appears in SCOP 1.67
- d1mhqb_ appears in the current release, SCOPe 2.08
View in 3D
