Lineage for d1mhpy_ (1mhp Y:)

  1. Root: SCOP 1.71
  2. 546417Class b: All beta proteins [48724] (149 folds)
  3. 546418Fold b.1: Immunoglobulin-like beta-sandwich [48725] (25 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 546419Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 546420Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (28 proteins)
  6. 547289Protein Immunoglobulin light chain kappa variable domain, VL-kappa [88519] (14 species)
    VL-kappa domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VL-kappa domains with artificial or grafted exogenous CDRs are listed as engineered species
  7. 547290Species Engineered (including hybrid species) [88533] (52 PDB entries)
  8. 547337Domain d1mhpy_: 1mhp Y: [84972]
    Other proteins in same PDB: d1mhpa_, d1mhpb_, d1mhph1, d1mhph2, d1mhpl2, d1mhpx_
    part of humanized anti-alpha1 integrin I-domain Fab; only V domain is ordered
    complexed with mn; mutant

Details for d1mhpy_

PDB Entry: 1mhp (more details), 2.8 Å

PDB Description: Crystal structure of a chimeric alpha1 integrin I-domain in complex with the Fab fragment of a humanized neutralizing antibody

SCOP Domain Sequences for d1mhpy_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1mhpy_ b.1.1.1 (Y:) Immunoglobulin light chain kappa variable domain, VL-kappa {Engineered (including hybrid species)}
iqltqspsslsasvgdrvtitcsasssvnhmfwyqqkpgkapkpwiyltsnlasgvpsrf
sgsgsgtdytltisslqpedfatyycqqwsgnpwtfgqgtkveik

SCOP Domain Coordinates for d1mhpy_:

Click to download the PDB-style file with coordinates for d1mhpy_.
(The format of our PDB-style files is described here.)

Timeline for d1mhpy_: