Lineage for d1mhpy_ (1mhp Y:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2739519Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 2740696Protein Immunoglobulin light chain kappa variable domain, VL-kappa [88519] (16 species)
    VL-kappa domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VL-kappa domains with artificial or grafted exogenous CDRs are listed as engineered species
  7. 2740697Species Engineered (including hybrid species) [88533] (60 PDB entries)
    SQ NA # humanized antidoby; bactericidal Fab-h6831 ! SQ NA # Humanized antibody ! SQ NA # humanized antibody ! SQ NA # engineered antibody
  8. 2740743Domain d1mhpy_: 1mhp Y: [84972]
    Other proteins in same PDB: d1mhpa_, d1mhpb_, d1mhph1, d1mhph2, d1mhpl2, d1mhpx_
    part of humanized anti-alpha1 integrin I-domain Fab; only V domain is ordered
    complexed with mn

Details for d1mhpy_

PDB Entry: 1mhp (more details), 2.8 Å

PDB Description: crystal structure of a chimeric alpha1 integrin i-domain in complex with the fab fragment of a humanized neutralizing antibody
PDB Compounds: (Y:) Fab fragment, light chain

SCOPe Domain Sequences for d1mhpy_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1mhpy_ b.1.1.1 (Y:) Immunoglobulin light chain kappa variable domain, VL-kappa {Engineered (including hybrid species)}
iqltqspsslsasvgdrvtitcsasssvnhmfwyqqkpgkapkpwiyltsnlasgvpsrf
sgsgsgtdytltisslqpedfatyycqqwsgnpwtfgqgtkveik

SCOPe Domain Coordinates for d1mhpy_:

Click to download the PDB-style file with coordinates for d1mhpy_.
(The format of our PDB-style files is described here.)

Timeline for d1mhpy_: