![]() | Class b: All beta proteins [48724] (126 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.1: Immunoglobulin [48726] (4 families) ![]() |
![]() | Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (22 proteins) |
![]() | Protein Immunoglobulin light chain kappa constant domain, CL-kappa [88566] (3 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [88569] (62 PDB entries) including humanized antibodies (chimeric proteins with human constant domains) |
![]() | Domain d1mhpl2: 1mhp L:107-213 [84970] Other proteins in same PDB: d1mhpa_, d1mhpb_, d1mhph1, d1mhph2, d1mhpl1, d1mhpx_, d1mhpy_ part of humanized anti-alpha1 integrin I-domain Fab complexed with mn; mutant |
PDB Entry: 1mhp (more details), 2.8 Å
SCOP Domain Sequences for d1mhpl2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1mhpl2 b.1.1.2 (L:107-213) Immunoglobulin light chain kappa constant domain, CL-kappa {Human (Homo sapiens)} rtvaapsvfifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqd skdstyslsstltlskadyekhkvyacevthqglsspvtksfnrgec
Timeline for d1mhpl2: