Lineage for d1mhph2 (1mhp H:119-219)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 651987Fold b.1: Immunoglobulin-like beta-sandwich [48725] (27 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 651988Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 654118Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins)
  6. 655111Protein Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma [88574] (5 species)
  7. 655115Species Human (Homo sapiens) [TaxId:9606] [88575] (150 PDB entries)
    including humanized antibodies (chimeric proteins with human constant domains)
  8. 655271Domain d1mhph2: 1mhp H:119-219 [84968]
    Other proteins in same PDB: d1mhpa_, d1mhpb_, d1mhph1, d1mhpl1, d1mhpl2, d1mhpx_, d1mhpy_
    part of humanized anti-alpha1 integrin I-domain Fab
    complexed with mn; mutant

Details for d1mhph2

PDB Entry: 1mhp (more details), 2.8 Å

PDB Description: Crystal structure of a chimeric alpha1 integrin I-domain in complex with the Fab fragment of a humanized neutralizing antibody
PDB Compounds: (H:) Fab fragment, heavy chain

SCOP Domain Sequences for d1mhph2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1mhph2 b.1.1.2 (H:119-219) Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma {Human (Homo sapiens) [TaxId: 9606]}
astkgpsvfplapsskstsggtaalgclvkdyfpepvtvswnsgaltsgvhtfpavlqss
glyslssvvtvpssslgtqtyicnvnhkpsntkvdkkvepk

SCOP Domain Coordinates for d1mhph2:

Click to download the PDB-style file with coordinates for d1mhph2.
(The format of our PDB-style files is described here.)

Timeline for d1mhph2: