SCOP 1.71: Domain d1mhph2: 1mhp H:119-219

Lineage for d1mhph2 (1mhp H:119-219)

1. Root: SCOP 1.71

2. Class b: All beta proteins [48724] (149 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (25 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins)

6. Protein Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma [88574] (5 species)

7. Species Human (Homo sapiens) [TaxId:9606] [88575] (105 PDB entries)
   including humanized antibodies (chimeric proteins with human constant domains)

8. Domain d1mhph2: 1mhp H:119-219 [84968]
   Other proteins in same PDB: d1mhpa_, d1mhpb_, d1mhph1, d1mhpl1, d1mhpl2, d1mhpx_, d1mhpy_
   part of humanized anti-alpha1 integrin I-domain Fab
   complexed with mn; mutant

Details for d1mhph2

PDB Entry: 1mhp, 2.8 Å

PDB Description: Crystal structure of a chimeric alpha1 integrin I-domain in complex with the Fab fragment of a humanized neutralizing antibody

SCOP Domain Sequences for d1mhph2:

Sequence; same for both SEQRES and ATOM records:

>d1mhph2 b.1.1.2 (H:119-219) Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma {Human (Homo sapiens)}
astkgpsvfplapsskstsggtaalgclvkdyfpepvtvswnsgaltsgvhtfpavlqss
glyslssvvtvpssslgtqtyicnvnhkpsntkvdkkvepk

Timeline for d1mhph2:

• d1mhph2 first appeared in SCOP 1.65
  
• d1mhph2 appears in SCOP 1.69
  
• d1mhph2 appears in SCOP 1.73
  
• d1mhph2 appears in the current release, SCOPe 2.07