![]() | Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
![]() | Fold c.62: vWA-like [53299] (1 superfamily) core: 3 layers, a/b/a; mixed beta-sheet of 6 strands, order 321456; strand 3 is antiparallel to the rest |
![]() | Superfamily c.62.1: vWA-like [53300] (6 families) ![]() |
![]() | Family c.62.1.1: Integrin A (or I) domain [53301] (11 proteins) |
![]() | Protein Integrin alpha1-beta1 [53310] (2 species) |
![]() | Species Norway rat (Rattus norvegicus) [TaxId:10116] [53312] (3 PDB entries) |
![]() | Domain d1mhpb_: 1mhp B: [84966] Other proteins in same PDB: d1mhph1, d1mhph2, d1mhpl1, d1mhpl2, d1mhpx_, d1mhpy_ complexed with humanized neutralizing Fab complexed with mn |
PDB Entry: 1mhp (more details), 2.8 Å
SCOPe Domain Sequences for d1mhpb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1mhpb_ c.62.1.1 (B:) Integrin alpha1-beta1 {Norway rat (Rattus norvegicus) [TaxId: 10116]} tqldivivldgsnsiypwesviaflndllkrmdigpkqtqvgivqygenvthefnlnkys steevlvaankivqrggrqtmtalgidtarkeafteargarrgvkkvmvivtdgeshdny rlkqviqdcedeniqrfsiailghynrgnlstekfveeiksiaseptekhffnvsdelal vtivkalgerif
Timeline for d1mhpb_: