SCOP 1.73: Domain d1mh8a_: 1mh8 A:

Lineage for d1mh8a_ (1mh8 A:)

1. Root: SCOP 1.73

2. Class a: All alpha proteins [46456] (258 folds)

3. Fold a.133: Phospholipase A2, PLA2 [48618] (1 superfamily)
   common core: 2 helices, disulfide-linked, and a calcium-binding loop

4. Superfamily a.133.1: Phospholipase A2, PLA2 [48619] (3 families)

5. Family a.133.1.2: Vertebrate phospholipase A2 [48623] (2 proteins)

6. Protein Snake phospholipase A2 [48624] (35 species)

7. Species Indian cobra (Naja naja sagittifera), calcium-free isoform 5 [TaxId:195058] [89172] (2 PDB entries)

8. Domain d1mh8a_: 1mh8 A: [84963]
   possibly another isoform with isoleucine at second position

Details for d1mh8a_

PDB Entry: 1mh8, 1.86 Å

PDB Description: Crystal Structure of a Phopholipase A2 Monomer with Isoleucine at Second Position

PDB Compounds: (A:) phospholipase a2

SCOP Domain Sequences for d1mh8a_:

Sequence; same for both SEQRES and ATOM records:

>d1mh8a_ a.133.1.2 (A:) Snake phospholipase A2 {Indian cobra (Naja naja sagittifera), calcium-free isoform 5 [TaxId: 195058]}
niyqfknmiectvparswwdfadygcycggggsgtptddldrccqvhdncynqaqeitgc
rpkwktytyqctqgtltckgrnnacaattcdcdrlaaicfagapyndtnynidlkarcq

Timeline for d1mh8a_:

• d1mh8a_ first appeared in SCOP 1.65
  
• d1mh8a_ appears in SCOP 1.71
  
• d1mh8a_ appears in SCOP 1.75
  
• d1mh8a_ appears in the current release, SCOPe 2.08