Lineage for d1mh7a_ (1mh7 A:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2732915Fold a.133: Phospholipase A2, PLA2 [48618] (1 superfamily)
    common core: 2 helices, disulfide-linked, and a calcium-binding loop
  4. 2732916Superfamily a.133.1: Phospholipase A2, PLA2 [48619] (4 families) (S)
  5. 2732921Family a.133.1.2: Vertebrate phospholipase A2 [48623] (3 proteins)
    automatically mapped to Pfam PF00068
  6. 2733039Protein Snake phospholipase A2 [48624] (38 species)
  7. 2733042Species Andaman cobra (Naja sagittifera), calcium-free isoform 5 [TaxId:195058] [89172] (2 PDB entries)
  8. 2733044Domain d1mh7a_: 1mh7 A: [84962]

Details for d1mh7a_

PDB Entry: 1mh7 (more details), 2 Å

PDB Description: Crystal Structure of a Calcium-Free Isoform of Phospholipase A2 from Naja naja sagittifera at 2.0 A Resolution
PDB Compounds: (A:) phospholipase a2

SCOPe Domain Sequences for d1mh7a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1mh7a_ a.133.1.2 (A:) Snake phospholipase A2 {Andaman cobra (Naja sagittifera), calcium-free isoform 5 [TaxId: 195058]}
nlyqfknmiectvparswwdfadygcycggggsgtptddldrccqvhdncynqaqeitgc
rpkwktytyqctqgtltckgrnnscaattcdcdrlaaicfagapyndtnynidlkarcq

SCOPe Domain Coordinates for d1mh7a_:

Click to download the PDB-style file with coordinates for d1mh7a_.
(The format of our PDB-style files is described here.)

Timeline for d1mh7a_: