SCOP 1.71: Domain d1mh2a_: 1mh2 A:

Lineage for d1mh2a_ (1mh2 A:)

1. Root: SCOP 1.71

2. Class a: All alpha proteins [46456] (226 folds)

3. Fold a.133: Phospholipase A2, PLA2 [48618] (1 superfamily)
   common core: 2 helices, disulfide-linked, and a calcium-binding loop

4. Superfamily a.133.1: Phospholipase A2, PLA2 [48619] (3 families)

5. Family a.133.1.2: Vertebrate phospholipase A2 [48623] (2 proteins)

6. Protein Snake phospholipase A2 [48624] (35 species)

7. Species Indian cobra (Naja naja sagittifera), isoform 2 [TaxId:195058] [89169] (2 PDB entries)
   heterodimer of two different isoforms

8. Domain d1mh2a_: 1mh2 A: [84960]
   zinc containing heterodimer of two different isoforms
   complexed with acy, zn

Details for d1mh2a_

PDB Entry: 1mh2, 2.7 Å

PDB Description: Crystal Structure of a Zinc Containing Dimer of Phospholipase A2 from the Venom of Indian Cobra (Naja Naja Sagittifera)

SCOP Domain Sequences for d1mh2a_:

Sequence; same for both SEQRES and ATOM records:

>d1mh2a_ a.133.1.2 (A:) Snake phospholipase A2 {Indian cobra (Naja naja sagittifera), isoform 2}
ntyqfqnmiqctvpkrswrdfadygcycgrggsgtpiddldsccqvhdncynsareqggc
rpkqktytyqckagglscsgannscaattcdcdrlaaicfagapyndnnynidlkarcq

Timeline for d1mh2a_:

• d1mh2a_ first appeared in SCOP 1.65
  
• d1mh2a_ appears in SCOP 1.69
  
• d1mh2a_ appears in SCOP 1.73
  
• d1mh2a_ appears in the current release, SCOPe 2.08