Lineage for d1mg7a1 (1mg7 A:14-187)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2537228Fold d.14: Ribosomal protein S5 domain 2-like [54210] (1 superfamily)
    core: beta(3)-alpha-beta-alpha; 2 layers: alpha/beta; left-handed crossover
  4. 2537229Superfamily d.14.1: Ribosomal protein S5 domain 2-like [54211] (13 families) (S)
  5. 2537807Family d.14.1.6: Early switch protein XOL-1, N-terminal domain [89824] (1 protein)
    diverged from the GHMP Kinase family; lost the ATP-binding site
    automatically mapped to Pfam PF09108
  6. 2537808Protein Early switch protein XOL-1, N-terminal domain [89825] (1 species)
  7. 2537809Species Nematode (Caenorhabditis elegans) [TaxId:6239] [89826] (1 PDB entry)
  8. 2537810Domain d1mg7a1: 1mg7 A:14-187 [84954]
    Other proteins in same PDB: d1mg7a2, d1mg7b2

Details for d1mg7a1

PDB Entry: 1mg7 (more details), 1.55 Å

PDB Description: crystal structure of xol-1
PDB Compounds: (A:) early switch protein xol-1 2.2k splice form

SCOPe Domain Sequences for d1mg7a1:

Sequence, based on SEQRES records: (download)

>d1mg7a1 d.14.1.6 (A:14-187) Early switch protein XOL-1, N-terminal domain {Nematode (Caenorhabditis elegans) [TaxId: 6239]}
errvkilgidrsenspvltymeteddpnfrnsklaaaphtvhmmdsgflainrqclvkgk
ailarepkssnehmiddlpkhahdqhtlsilrdfidqlklhnvyeinfydpldssgklav
ipmlialwkcmlasetdicdqevlksimnsviakfelqipcknavidatlsgsr

Sequence, based on observed residues (ATOM records): (download)

>d1mg7a1 d.14.1.6 (A:14-187) Early switch protein XOL-1, N-terminal domain {Nematode (Caenorhabditis elegans) [TaxId: 6239]}
errvkilgidrsenspvltymsklaaaphtvhmmdsgflainrqclvkgkailarepkss
nehmiddlpkhahdqhtlsilrdfidqlklhnvyeinfydpldssgklavipmlialwkc
mlasetdicdqevlksimnsviakfelqipcknavidatlsgsr

SCOPe Domain Coordinates for d1mg7a1:

Click to download the PDB-style file with coordinates for d1mg7a1.
(The format of our PDB-style files is described here.)

Timeline for d1mg7a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1mg7a2