Class c: Alpha and beta proteins (a/b) [51349] (121 folds) |
Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily) core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456 The nucleotide-binding modes of this and the next two folds/superfamilies are similar |
Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (10 families) |
Family c.2.1.6: 6-phosphogluconate dehydrogenase-like, N-terminal domain [51868] (12 proteins) the beta-sheet is extended to 8 strands, order 32145678; strands 7 & 8 are antiparallel to the rest C-terminal domains also show some similarity |
Protein GDP-mannose 6-dehydrogenase [89534] (1 species) |
Species Pseudomonas aeruginosa [TaxId:287] [89535] (3 PDB entries) |
Domain d1mfzc2: 1mfz C:1-202 [84948] Other proteins in same PDB: d1mfza1, d1mfza3, d1mfzb1, d1mfzb3, d1mfzc1, d1mfzc3, d1mfzd1, d1mfzd3 |
PDB Entry: 1mfz (more details), 2.8 Å
SCOP Domain Sequences for d1mfzc2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1mfzc2 c.2.1.6 (C:1-202) GDP-mannose 6-dehydrogenase {Pseudomonas aeruginosa} mrisifglgyvgavcagclsarghevigvdvsstkidlinqgkspivepgleallqqgrq tgrlsgttdfkkavldsdvsficvgtpskkngdldlgyietvcreigfairekserhtvv vrstvlpgtvnnvvipliedcsgkkagvdfgvgtnpeflrestaikdydfppmtvigeld kqtgdlleeiyreldapiirkt
Timeline for d1mfzc2: