Lineage for d1mfzb3 (1mfz B:301-436)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2468308Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies)
    core: 3 layers, a/b/a ; parallel beta-sheet of 5 strands, order 32145
  4. 2469941Superfamily c.26.3: UDP-glucose/GDP-mannose dehydrogenase C-terminal domain [52413] (1 family) (S)
  5. 2469942Family c.26.3.1: UDP-glucose/GDP-mannose dehydrogenase C-terminal domain [52414] (2 proteins)
  6. 2469943Protein GDP-mannose 6-dehydrogenase, GDP-binding domain [89617] (1 species)
  7. 2469944Species Pseudomonas aeruginosa [TaxId:287] [89618] (3 PDB entries)
  8. 2469954Domain d1mfzb3: 1mfz B:301-436 [84946]
    Other proteins in same PDB: d1mfza1, d1mfza2, d1mfzb1, d1mfzb2, d1mfzc1, d1mfzc2, d1mfzd1, d1mfzd2
    complexed with gdx

Details for d1mfzb3

PDB Entry: 1mfz (more details), 2.8 Å

PDB Description: Partially refined 2.8 A Crystal structure of GDP-mannose dehydrogenase from P. aeruginosa
PDB Compounds: (B:) GDP-mannose 6-dehydrogenase

SCOPe Domain Sequences for d1mfzb3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1mfzb3 c.26.3.1 (B:301-436) GDP-mannose 6-dehydrogenase, GDP-binding domain {Pseudomonas aeruginosa [TaxId: 287]}
vqkafdlitshdtrkvgllglsfkagtddlresplvelaemligkgyelrifdrnveyar
vhgankeyieskiphvssllvsdldevvassdvlvlgngdelfvdlvnktpsgkklvdlv
gfmphtttaqaegicw

SCOPe Domain Coordinates for d1mfzb3:

Click to download the PDB-style file with coordinates for d1mfzb3.
(The format of our PDB-style files is described here.)

Timeline for d1mfzb3: