Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies) core: 3 layers, a/b/a ; parallel beta-sheet of 5 strands, order 32145 |
Superfamily c.26.3: UDP-glucose/GDP-mannose dehydrogenase C-terminal domain [52413] (1 family) |
Family c.26.3.1: UDP-glucose/GDP-mannose dehydrogenase C-terminal domain [52414] (2 proteins) |
Protein GDP-mannose 6-dehydrogenase, GDP-binding domain [89617] (1 species) |
Species Pseudomonas aeruginosa [TaxId:287] [89618] (3 PDB entries) |
Domain d1mfzb3: 1mfz B:301-436 [84946] Other proteins in same PDB: d1mfza1, d1mfza2, d1mfzb1, d1mfzb2, d1mfzc1, d1mfzc2, d1mfzd1, d1mfzd2 complexed with gdx |
PDB Entry: 1mfz (more details), 2.8 Å
SCOPe Domain Sequences for d1mfzb3:
Sequence; same for both SEQRES and ATOM records: (download)
>d1mfzb3 c.26.3.1 (B:301-436) GDP-mannose 6-dehydrogenase, GDP-binding domain {Pseudomonas aeruginosa [TaxId: 287]} vqkafdlitshdtrkvgllglsfkagtddlresplvelaemligkgyelrifdrnveyar vhgankeyieskiphvssllvsdldevvassdvlvlgngdelfvdlvnktpsgkklvdlv gfmphtttaqaegicw
Timeline for d1mfzb3: