Class a: All alpha proteins [46456] (289 folds) |
Fold a.100: 6-phosphogluconate dehydrogenase C-terminal domain-like [48178] (1 superfamily) multihelical; common core is formed around two long antiparallel helices related by (pseudo) twofold symmetry |
Superfamily a.100.1: 6-phosphogluconate dehydrogenase C-terminal domain-like [48179] (13 families) N-terminal domain is Rossmann-fold with a family-specific C-terminal extension |
Family a.100.1.4: UDP-glucose/GDP-mannose dehydrogenase dimerisation domain [48191] (2 proteins) automatically mapped to Pfam PF00984 |
Protein GDP-mannose 6-dehydrogenase, middle domain [89103] (1 species) forms segment-swapped dimer, unlike the homologous UDPGDH domain |
Species Pseudomonas aeruginosa [TaxId:287] [89104] (3 PDB entries) |
Domain d1mfzb1: 1mfz B:203-300 [84944] Other proteins in same PDB: d1mfza2, d1mfza3, d1mfzb2, d1mfzb3, d1mfzc2, d1mfzc3, d1mfzd2, d1mfzd3 complexed with gdx |
PDB Entry: 1mfz (more details), 2.8 Å
SCOPe Domain Sequences for d1mfzb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1mfzb1 a.100.1.4 (B:203-300) GDP-mannose 6-dehydrogenase, middle domain {Pseudomonas aeruginosa [TaxId: 287]} vevaemikytcnvwhaakvtfaneigniakavgvdgrevmdvicqdhklnlsryymrpgf afggsclpkdvraltyrasqldvehpmlgslmrsnsnq
Timeline for d1mfzb1: