Lineage for d1mfza1 (1mfz A:203-300)

  1. Root: SCOPe 2.05
  2. 1715731Class a: All alpha proteins [46456] (286 folds)
  3. 1742411Fold a.100: 6-phosphogluconate dehydrogenase C-terminal domain-like [48178] (1 superfamily)
    multihelical; common core is formed around two long antiparallel helices related by (pseudo) twofold symmetry
  4. 1742412Superfamily a.100.1: 6-phosphogluconate dehydrogenase C-terminal domain-like [48179] (13 families) (S)
    N-terminal domain is Rossmann-fold with a family-specific C-terminal extension
  5. 1742518Family a.100.1.4: UDP-glucose/GDP-mannose dehydrogenase dimerisation domain [48191] (2 proteins)
    automatically mapped to Pfam PF00984
  6. 1742519Protein GDP-mannose 6-dehydrogenase, middle domain [89103] (1 species)
    forms segment-swapped dimer, unlike the homologous UDPGDH domain
  7. 1742520Species Pseudomonas aeruginosa [TaxId:287] [89104] (3 PDB entries)
  8. 1742529Domain d1mfza1: 1mfz A:203-300 [84941]
    Other proteins in same PDB: d1mfza2, d1mfza3, d1mfzb2, d1mfzb3, d1mfzc2, d1mfzc3, d1mfzd2, d1mfzd3
    complexed with gdx

Details for d1mfza1

PDB Entry: 1mfz (more details), 2.8 Å

PDB Description: Partially refined 2.8 A Crystal structure of GDP-mannose dehydrogenase from P. aeruginosa
PDB Compounds: (A:) GDP-mannose 6-dehydrogenase

SCOPe Domain Sequences for d1mfza1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1mfza1 a.100.1.4 (A:203-300) GDP-mannose 6-dehydrogenase, middle domain {Pseudomonas aeruginosa [TaxId: 287]}
vevaemikytcnvwhaakvtfaneigniakavgvdgrevmdvicqdhklnlsryymrpgf
afggsclpkdvraltyrasqldvehpmlgslmrsnsnq

SCOPe Domain Coordinates for d1mfza1:

Click to download the PDB-style file with coordinates for d1mfza1.
(The format of our PDB-style files is described here.)

Timeline for d1mfza1: