Lineage for d1mfza1 (1mfz A:203-300)

  1. Root: SCOP 1.65
  2. 275720Class a: All alpha proteins [46456] (179 folds)
  3. 284127Fold a.100: 6-phosphogluconate dehydrogenase C-terminal domain-like [48178] (1 superfamily)
    multihelical; common core is formed around two long antiparallel helices related by (pseudo) twofold symmetry
  4. 284128Superfamily a.100.1: 6-phosphogluconate dehydrogenase C-terminal domain-like [48179] (9 families) (S)
    N-terminal domain is Rossmann-fold with a family-specific C-terminal extension
  5. 284178Family a.100.1.4: UDP-glucose/GDP-mannose dehydrogenase dimerisation domain [48191] (2 proteins)
  6. 284179Protein GDP-mannose 6-dehydrogenase, middle domain [89103] (1 species)
    forms segment-swapped dimer, unlike the homologous UDPGDH domain
  7. 284180Species Pseudomonas aeruginosa [TaxId:287] [89104] (3 PDB entries)
  8. 284189Domain d1mfza1: 1mfz A:203-300 [84941]
    Other proteins in same PDB: d1mfza2, d1mfza3, d1mfzb2, d1mfzb3, d1mfzc2, d1mfzc3, d1mfzd2, d1mfzd3

Details for d1mfza1

PDB Entry: 1mfz (more details), 2.8 Å

PDB Description: Partially refined 2.8 A Crystal structure of GDP-mannose dehydrogenase from P. aeruginosa

SCOP Domain Sequences for d1mfza1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1mfza1 a.100.1.4 (A:203-300) GDP-mannose 6-dehydrogenase, middle domain {Pseudomonas aeruginosa}
vevaemikytcnvwhaakvtfaneigniakavgvdgrevmdvicqdhklnlsryymrpgf
afggsclpkdvraltyrasqldvehpmlgslmrsnsnq

SCOP Domain Coordinates for d1mfza1:

Click to download the PDB-style file with coordinates for d1mfza1.
(The format of our PDB-style files is described here.)

Timeline for d1mfza1: