Lineage for d1mdwa_ (1mdw A:)

  1. Root: SCOPe 2.06
  2. 2152203Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2154577Fold d.3: Cysteine proteinases [54000] (1 superfamily)
    consists of one alpha-helix and 4 strands of antiparallel beta-sheet and contains the catalytic triad Cys-His-Asn
  4. 2154578Superfamily d.3.1: Cysteine proteinases [54001] (24 families) (S)
    the constitute families differ by insertion into and circular permutation of the common catalytic core made of one alpha-helix and 3-strands of beta-sheet
  5. 2155026Family d.3.1.3: Calpain large subunit, catalytic domain (domain II) [54040] (1 protein)
    automatically mapped to Pfam PF00648
  6. 2155027Protein Calpain large subunit, catalytic domain (domain II) [54041] (6 species)
    includes the N-terminal 'sequence' domain I
  7. 2155040Species Norway rat (Rattus norvegicus), M-type [TaxId:10116] [54043] (3 PDB entries)
  8. 2155041Domain d1mdwa_: 1mdw A: [84934]
    calcium-bound protease core
    complexed with ca

Details for d1mdwa_

PDB Entry: 1mdw (more details), 1.95 Å

PDB Description: Crystal Structure of Calcium-Bound Protease Core of Calpain II Reveals the Basis for Intrinsic Inactivation
PDB Compounds: (A:) Calpain II, catalytic subunit

SCOPe Domain Sequences for d1mdwa_:

Sequence, based on SEQRES records: (download)

>d1mdwa_ d.3.1.3 (A:) Calpain large subunit, catalytic domain (domain II) {Norway rat (Rattus norvegicus), M-type [TaxId: 10116]}
eraikylnqdyetlrnecleagalfqdpsfpalpsslgfkelgpyssktrgiewkrptei
cadpqfiiggatrtdicqgalgdswllaaiasltlneeilarvvpldqsfqenyagifhf
qfwqygewvevvvddrlptkdgellfvhsaegsefwsallekayakingcyealsggatt
egfedftggiaewyelrkpppnlfkiiqkalekgsllgcsiditsaadseavtyqklvkg
haysvtgaeevessgslqklirirnpwgqvewtgkwndncpswntvdpevranlterqed
gefwmsfsdflrhysrleicnlt

Sequence, based on observed residues (ATOM records): (download)

>d1mdwa_ d.3.1.3 (A:) Calpain large subunit, catalytic domain (domain II) {Norway rat (Rattus norvegicus), M-type [TaxId: 10116]}
eraikylnqdyetlrnecleagalfqdpsfpalpsslgfkelgpyssktrgiewkrptei
cadpqfiiggatrtdicqgalgdswllaaiasltlneeilarvvpldqsfqenyagifhf
qfwqygewvevvvddrlptkdgellfvhsaegsefwsallekayakingcyealsgegfe
dftggiaewyelrkpppnlfkiiqkalekgsllgcsiditsaadseavtyqklvkghays
vtgaeevessgslqklirirnpwgqvewtgkwndncpswntvdpevranlterqedgefw
msfsdflrhysrleicnlt

SCOPe Domain Coordinates for d1mdwa_:

Click to download the PDB-style file with coordinates for d1mdwa_.
(The format of our PDB-style files is described here.)

Timeline for d1mdwa_: