Lineage for d1mcxa_ (1mcx A:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2000010Fold a.65: Annexin [47873] (1 superfamily)
    5 helices; folded leaf, closed
  4. 2000011Superfamily a.65.1: Annexin [47874] (2 families) (S)
    duplication: consists of four domains of the same fold
  5. 2000012Family a.65.1.1: Annexin [47875] (10 protein domains)
  6. 2000016Protein Annexin I [47876] (2 species)
  7. 2000020Species Pig (Sus scrofa) [TaxId:9823] [47878] (2 PDB entries)
  8. 2000023Domain d1mcxa_: 1mcx A: [84933]
    complexed with ca

Details for d1mcxa_

PDB Entry: 1mcx (more details), 2.03 Å

PDB Description: structure of full-length annexin a1 in the presence of calcium
PDB Compounds: (A:) annexin I

SCOPe Domain Sequences for d1mcxa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1mcxa_ a.65.1.1 (A:) Annexin I {Pig (Sus scrofa) [TaxId: 9823]}
tfnpssdvealhkaitvkgvdeatiieiltkrtnaqrqqikaaylqekgkpldealkkal
tghleevalallktpaqfdadelraamkglgtdedtlneilasrtnreireinrvykeel
krdlakditsdtsgdyqkallslakgdrsedlainddladtdaralyeagerrkgtdlnv
fitilttrsyphlrrvfqkyskyskhdmnkvldlelkgdiencltvvvkcatskpmffae
klhqamkgigtrhktlirimvsrseidmndikacyqklygislcqaildetkgdyekilv
alcg

SCOPe Domain Coordinates for d1mcxa_:

Click to download the PDB-style file with coordinates for d1mcxa_.
(The format of our PDB-style files is described here.)

Timeline for d1mcxa_: