Lineage for d1mc4a2 (1mc4 A:133-354)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2203126Fold d.81: FwdE/GAPDH domain-like [55346] (4 superfamilies)
    core: alpha-beta-alpha-beta(3); mixed sheet: 2134, strand 2 is parallel to strand 1
  4. 2203127Superfamily d.81.1: Glyceraldehyde-3-phosphate dehydrogenase-like, C-terminal domain [55347] (5 families) (S)
    N-terminal domain is the classic Rossmann-fold
  5. 2203128Family d.81.1.1: GAPDH-like [55348] (6 proteins)
    has many additional secondary structures
  6. 2203135Protein Aspartate beta-semialdehyde dehydrogenase [55361] (4 species)
  7. 2203211Species Vibrio cholerae [TaxId:666] [82725] (4 PDB entries)
  8. 2203218Domain d1mc4a2: 1mc4 A:133-354 [84928]
    Other proteins in same PDB: d1mc4a1

Details for d1mc4a2

PDB Entry: 1mc4 (more details), 2.77 Å

PDB Description: Crystal Structure of Aspartate-Semialdehyde dehydrogenase from Vibrio Cholerae El Tor
PDB Compounds: (A:) aspartate-semialdehyde dehydrogenase

SCOPe Domain Sequences for d1mc4a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1mc4a2 d.81.1.1 (A:133-354) Aspartate beta-semialdehyde dehydrogenase {Vibrio cholerae [TaxId: 666]}
nctvslmlmalgglyerglvewmsamtyqaasgagaqnmrelisqmgvindavsselanp
assildidkkvaetmrsgsfptdnfgvplagslipwidvkrdngqskeewkagveankil
glqdspvpidgtcvrigamrchsqaltiklkqnipldeieemiathndwvkvipnerdit
areltpakvtgtlsvpvgrlrkmamgddflnaftvgdqllwg

SCOPe Domain Coordinates for d1mc4a2:

Click to download the PDB-style file with coordinates for d1mc4a2.
(The format of our PDB-style files is described here.)

Timeline for d1mc4a2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1mc4a1