Lineage for d1mc4a2 (1mc4 A:133-354)
- Root: SCOP 1.67
Class d: Alpha and beta proteins (a+b) [53931] (260 folds) 
Fold d.81: Glyceraldehyde-3-phosphate dehydrogenase-like, C-terminal domain [55346] (1 superfamily)
core: alpha-beta-alpha-beta(3); mixed sheet: 2134, strand 2 is parallel to strand 1Superfamily d.81.1: Glyceraldehyde-3-phosphate dehydrogenase-like, C-terminal domain [55347] (5 families) 
N-terminal domain is the classic Rossmann-fold
Family d.81.1.1: GAPDH-like [55348] (3 proteins)
has many additional secondary structures
Protein Aspartate beta-semialdehyde dehydrogenase [55361] (3 species) 
Species Vibrio cholerae [TaxId:666] [82725] (2 PDB entries) 
Domain d1mc4a2: 1mc4 A:133-354 [84928]
Other proteins in same PDB: d1mc4a1
Details for d1mc4a2
PDB Entry: 1mc4 (more details), 2.77 Å
PDB Description: Crystal Structure of Aspartate-Semialdehyde dehydrogenase from Vibrio Cholerae El Tor
SCOP Domain Sequences for d1mc4a2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1mc4a2 d.81.1.1 (A:133-354) Aspartate beta-semialdehyde dehydrogenase {Vibrio cholerae}
nctvslmlmalgglyerglvewmsamtyqaasgagaqnmrelisqmgvindavsselanp
assildidkkvaetmrsgsfptdnfgvplagslipwidvkrdngqskeewkagveankil
glqdspvpidgtcvrigamrchsqaltiklkqnipldeieemiathndwvkvipnerdit
areltpakvtgtlsvpvgrlrkmamgddflnaftvgdqllwg
SCOP Domain Coordinates for d1mc4a2:
Click to download the PDB-style file with coordinates for d1mc4a2.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1mc4a2:
- d1mc4a2 first appeared in SCOP 1.65
- d1mc4a2 appears in SCOP 1.69
- d1mc4a2 appears in the current release, SCOPe 2.08
View in 3D
