SCOPe 2.05: Domain d1mc4a1: 1mc4 A:1-132,A:355-369

Lineage for d1mc4a1 (1mc4 A:1-132,A:355-369)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
   core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
   The nucleotide-binding modes of this and the next two folds/superfamilies are similar

4. Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families)

5. Family c.2.1.3: Glyceraldehyde-3-phosphate dehydrogenase-like, N-terminal domain [51800] (22 proteins)
   family members also share a common alpha+beta fold in C-terminal domain

6. Protein Aspartate beta-semialdehyde dehydrogenase [51813] (4 species)

7. Species Vibrio cholerae [TaxId:666] [82297] (4 PDB entries)

8. Domain d1mc4a1: 1mc4 A:1-132,A:355-369 [84927]
   Other proteins in same PDB: d1mc4a2

Details for d1mc4a1

PDB Entry: 1mc4, 2.77 Å

PDB Description: Crystal Structure of Aspartate-Semialdehyde dehydrogenase from Vibrio Cholerae El Tor

PDB Compounds: (A:) aspartate-semialdehyde dehydrogenase

SCOPe Domain Sequences for d1mc4a1:

Sequence; same for both SEQRES and ATOM records:

>d1mc4a1 c.2.1.3 (A:1-132,A:355-369) Aspartate beta-semialdehyde dehydrogenase {Vibrio cholerae [TaxId: 666]}
mrvglvgwrgmvgsvlmqrmveerdfdliepvffstsqigvpapnfgkdagmlhdafdie
slkqldavitcqggsytekvypalrqagwkgywidaastlrmdkeaiitldpvnlkqilh
gihhgtktfvggXaaeplrrtlriilae

Timeline for d1mc4a1:

• d1mc4a1 first appeared in SCOP 1.65
  
• d1mc4a1 appears in SCOPe 2.04
  
• d1mc4a1 appears in SCOPe 2.06
  
• d1mc4a1 appears in the current release, SCOPe 2.08