SCOP 1.65: Domain d1ma7b1: 1ma7 B:20-129

Lineage for d1ma7b1 (1ma7 B:20-129)

1. Root: SCOP 1.65

2. Class a: All alpha proteins [46456] (179 folds)

3. Fold a.60: SAM domain-like [47768] (13 superfamilies)
   4-5 helices; bundle of two orthogonally packed alpha-hairpins; involved in the interactions with DNA and proteins

4. Superfamily a.60.9: lambda integrase-like, N-terminal domain [47823] (1 family)

5. Family a.60.9.1: lambda integrase-like, N-terminal domain [47824] (3 proteins)

6. Protein Cre recombinase [47825] (1 species)

7. Species Bacteriophage P1 [TaxId:10678] [47826] (9 PDB entries)

8. Domain d1ma7b1: 1ma7 B:20-129 [84923]
   Other proteins in same PDB: d1ma7a2, d1ma7b2
   mutant

Details for d1ma7b1

PDB Entry: 1ma7, 2.3 Å

PDB Description: Crystal structure of Cre site-specific recombinase complexed with a mutant DNA substrate, LoxP-A8/T27

SCOP Domain Sequences for d1ma7b1:

Sequence; same for both SEQRES and ATOM records:

>d1ma7b1 a.60.9.1 (B:20-129) Cre recombinase {Bacteriophage P1}
sdevrknlmdmfrdrqafsehtwkmllsvcrswaawcklnnrkwfpaepedvrdyllylq
arglavktiqqhlgqlnmlhrrsglprpsdsnavslvmrrirkenvdage

Timeline for d1ma7b1:

• d1ma7b1 is new in SCOP 1.65
  
• d1ma7b1 appears in SCOP 1.67
  
• d1ma7b1 appears in the current release, SCOPe 2.08