| Class a: All alpha proteins [46456] (226 folds) | 
| Fold a.60: SAM domain-like [47768] (14 superfamilies) 4-5 helices; bundle of two orthogonally packed alpha-hairpins; involved in the interactions with DNA and proteins  | 
Superfamily a.60.9: lambda integrase-like, N-terminal domain [47823] (1 family) ![]()  | 
| Family a.60.9.1: lambda integrase-like, N-terminal domain [47824] (3 proteins) | 
| Protein Cre recombinase [47825] (1 species) | 
| Species Bacteriophage P1 [TaxId:10678] [47826] (18 PDB entries) | 
| Domain d1ma7a1: 1ma7 A:19-129 [84921] Other proteins in same PDB: d1ma7a2, d1ma7b2  | 
PDB Entry: 1ma7 (more details), 2.3 Å
SCOP Domain Sequences for d1ma7a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ma7a1 a.60.9.1 (A:19-129) Cre recombinase {Bacteriophage P1}
tsdevrknlmdmfrdrqafsehtwkmllsvcrswaawcklnnrkwfpaepedvrdyllyl
qarglavktiqqhlgqlnmlhrrsglprpsdsnavslvmrrirkenvdage
Timeline for d1ma7a1: