SCOPe 2.06: Domain d1m9yg_: 1m9y G:

Lineage for d1m9yg_ (1m9y G:)

1. Root: SCOPe 2.06

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.73: Retrovirus capsid protein, N-terminal core domain [47942] (1 superfamily)
   core: 5 helices; bundle

4. Superfamily a.73.1: Retrovirus capsid protein, N-terminal core domain [47943] (2 families)

5. Family a.73.1.1: Retrovirus capsid protein, N-terminal core domain [47944] (6 proteins)

6. Protein HIV-1 capsid protein [47945] (1 species)

7. Species Human immunodeficiency virus type 1 [TaxId:11676] [47946] (44 PDB entries)

8. Domain d1m9yg_: 1m9y G: [84919]
   Other proteins in same PDB: d1m9ya_, d1m9yb_, d1m9ye_, d1m9yf_

Details for d1m9yg_

PDB Entry: 1m9y, 1.9 Å

PDB Description: x-ray crystal structure of cyclophilin a/hiv-1 ca n-terminal domain (1-146) m-type h87a,g89a complex.

PDB Compounds: (G:) hiv-1 capsid

SCOPe Domain Sequences for d1m9yg_:

Sequence; same for both SEQRES and ATOM records:

>d1m9yg_ a.73.1.1 (G:) HIV-1 capsid protein {Human immunodeficiency virus type 1 [TaxId: 11676]}
pivqnlqgqmvhqaisprtlnawvkvveekafspevipmfsalsegatpqdlntmlntvg
ghqaamqmlketineeaaewdrlhpvaaapiapgqmreprgsdiagttstlqeqigwmth
nppipvgeiykrwiilglnkivrmys

Timeline for d1m9yg_:

• d1m9yg_ first appeared in SCOP 1.65
  
• d1m9yg_ appears in SCOPe 2.05
  
• d1m9yg_ appears in SCOPe 2.07
  
• d1m9yg_ appears in the current release, SCOPe 2.08