Lineage for d1m9ya_ (1m9y A:)

  1. Root: SCOP 1.75
  2. 781541Class b: All beta proteins [48724] (174 folds)
  3. 806745Fold b.62: Cyclophilin-like [50890] (1 superfamily)
    barrel, closed; n=8, S=10; complex topology
  4. 806746Superfamily b.62.1: Cyclophilin-like [50891] (4 families) (S)
  5. 806747Family b.62.1.1: Cyclophilin (peptidylprolyl isomerase) [50892] (12 proteins)
  6. 806748Protein Cyclophilin (eukaryotic) [50893] (13 species)
  7. 806767Species Human (Homo sapiens), variant A [TaxId:9606] [50894] (48 PDB entries)
    Uniprot P05092
  8. 806797Domain d1m9ya_: 1m9y A: [84913]
    Other proteins in same PDB: d1m9yc_, d1m9yd_, d1m9yg_, d1m9yh_

Details for d1m9ya_

PDB Entry: 1m9y (more details), 1.9 Å

PDB Description: x-ray crystal structure of cyclophilin a/hiv-1 ca n-terminal domain (1-146) m-type h87a,g89a complex.
PDB Compounds: (A:) cyclophilin a

SCOP Domain Sequences for d1m9ya_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1m9ya_ b.62.1.1 (A:) Cyclophilin (eukaryotic) {Human (Homo sapiens), variant A [TaxId: 9606]}
mvnptvffdiavdgeplgrvsfelfadkvpktaenfralstgekgfgykgscfhriipgf
mcqggdftrhngtggksiygekfedenfilkhtgpgilsmanagpntngsqffictakte
wldgkhvvfgkvkegmniveamerfgsrngktskkitiadcgqle

SCOP Domain Coordinates for d1m9ya_:

Click to download the PDB-style file with coordinates for d1m9ya_.
(The format of our PDB-style files is described here.)

Timeline for d1m9ya_: