Lineage for d1m9xe_ (1m9x E:)

  1. Root: SCOP 1.65
  2. 287094Class b: All beta proteins [48724] (126 folds)
  3. 301509Fold b.62: Cyclophilin (peptidylprolyl isomerase) [50890] (1 superfamily)
    barrel, closed; n=8, S=10; complex topology
  4. 301510Superfamily b.62.1: Cyclophilin (peptidylprolyl isomerase) [50891] (1 family) (S)
  5. 301511Family b.62.1.1: Cyclophilin (peptidylprolyl isomerase) [50892] (3 proteins)
  6. 301517Protein Cyclophilin (eukaryotic) [50893] (8 species)
  7. 301526Species Human (Homo sapiens), variant A [TaxId:9606] [50894] (42 PDB entries)
  8. 301535Domain d1m9xe_: 1m9x E: [84909]
    Other proteins in same PDB: d1m9xc_, d1m9xd_, d1m9xg_, d1m9xh_

Details for d1m9xe_

PDB Entry: 1m9x (more details), 1.7 Å

PDB Description: x-ray crystal structure of cyclophilin a/hiv-1 ca n-terminal domain (1-146) m-type h87a,a88m,g89a complex.

SCOP Domain Sequences for d1m9xe_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1m9xe_ b.62.1.1 (E:) Cyclophilin (eukaryotic) {Human (Homo sapiens), variant A}
mvnptvffdiavdgeplgrvsfelfadkvpktaenfralstgekgfgykgscfhriipgf
mcqggdftrhngtggksiygekfedenfilkhtgpgilsmanagpntngsqffictakte
wldgkhvvfgkvkegmniveamerfgsrngktskkitiadcgqle

SCOP Domain Coordinates for d1m9xe_:

Click to download the PDB-style file with coordinates for d1m9xe_.
(The format of our PDB-style files is described here.)

Timeline for d1m9xe_: