Lineage for d1m9xc_ (1m9x C:)

  1. Root: SCOP 1.75
  2. 758332Class a: All alpha proteins [46456] (284 folds)
  3. 772125Fold a.73: Retrovirus capsid protein, N-terminal core domain [47942] (1 superfamily)
    core: 5 helices; bundle
  4. 772126Superfamily a.73.1: Retrovirus capsid protein, N-terminal core domain [47943] (1 family) (S)
  5. 772127Family a.73.1.1: Retrovirus capsid protein, N-terminal core domain [47944] (5 proteins)
  6. 772141Protein HIV-1 capsid protein [47945] (1 species)
  7. 772142Species Human immunodeficiency virus type 1 [TaxId:11676] [47946] (15 PDB entries)
  8. 772146Domain d1m9xc_: 1m9x C: [84907]
    Other proteins in same PDB: d1m9xa_, d1m9xb_, d1m9xe_, d1m9xf_

Details for d1m9xc_

PDB Entry: 1m9x (more details), 1.7 Å

PDB Description: x-ray crystal structure of cyclophilin a/hiv-1 ca n-terminal domain (1-146) m-type h87a,a88m,g89a complex.
PDB Compounds: (C:) hiv-1 capsid

SCOP Domain Sequences for d1m9xc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1m9xc_ a.73.1.1 (C:) HIV-1 capsid protein {Human immunodeficiency virus type 1 [TaxId: 11676]}
pivqnlqgqmvhqaisprtlnawvkvveekafspevipmfsalsegatpqdlntmlntvg
ghqaamqmlketineeaaewdrlhpvamapiapgqmreprgsdiagttstlqeqigwmth
nppipvgeiykrwiilglnkivrmys

SCOP Domain Coordinates for d1m9xc_:

Click to download the PDB-style file with coordinates for d1m9xc_.
(The format of our PDB-style files is described here.)

Timeline for d1m9xc_: