Lineage for d1m9oa_ (1m9o A:)

  1. Root: SCOP 1.65
  2. 341323Class g: Small proteins [56992] (66 folds)
  3. 344836Fold g.66: CCCH zinc finger [90228] (1 superfamily)
    metal(zinc)-bound alpha+beta fold
  4. 344837Superfamily g.66.1: CCCH zinc finger [90229] (1 family) (S)
  5. 344838Family g.66.1.1: CCCH zinc finger [90230] (1 protein)
    C-x8-C-x5-C-x3-H type and similar
  6. 344839Protein Tristetraproline (ttp, tis11, nup475) [90231] (1 species)
  7. 344840Species Mouse (Mus musculus) [TaxId:10090] [90232] (1 PDB entry)
  8. 344841Domain d1m9oa_: 1m9o A: [84904]
    complexed with zn; mutant

Details for d1m9oa_

PDB Entry: 1m9o (more details)

PDB Description: nmr structure of the first zinc binding domain of nup475/ttp/tis11

SCOP Domain Sequences for d1m9oa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1m9oa_ g.66.1.1 (A:) Tristetraproline (ttp, tis11, nup475) {Mouse (Mus musculus)}
mttssryktelcrtysesgrcrygakcqfahglgelrqan

SCOP Domain Coordinates for d1m9oa_:

Click to download the PDB-style file with coordinates for d1m9oa_.
(The format of our PDB-style files is described here.)

Timeline for d1m9oa_: